PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN11631.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 236aa    MW: 26884.2 Da    PI: 8.2278
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN11631.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.88.9e-17956148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++ Ed ll d+v+++G g W++++++ g++R++k+c++rw++yl
       KHN11631.1  9 KGAWSQIEDNLLRDCVNLHGEGKWHLVPKRAGLNRCRKSCRLRWLNYL 56
                     79********************************************97 PP

2Myb_DNA-binding48.91.5e-1562107148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg ++++E +l ++++k+lG++ W++Ia +++ gRt +++k++w++y+
       KHN11631.1  62 RGDFSEDEVDLMIRLHKLLGNR-WSLIAGRLP-GRTSNDVKNYWNTYM 107
                      899*******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.334456IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.5E-21559IPR009057Homeodomain-like
SuperFamilySSF466893.3E-276103IPR009057Homeodomain-like
SMARTSM007171.4E-14858IPR001005SANT/Myb domain
PfamPF002491.4E-15956IPR001005SANT/Myb domain
CDDcd001677.49E-101156No hitNo description
PROSITE profilePS5129425.22757111IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.5E-2360111IPR009057Homeodomain-like
SMARTSM007172.0E-1461109IPR001005SANT/Myb domain
PfamPF002496.4E-1462106IPR001005SANT/Myb domain
CDDcd001671.17E-965107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009753Biological Processresponse to jasmonic acid
GO:0031540Biological Processregulation of anthocyanin biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MEGSSGVRKG AWSQIEDNLL RDCVNLHGEG KWHLVPKRAG LNRCRKSCRL RWLNYLKPNI  60
KRGDFSEDEV DLMIRLHKLL GNRWSLIAGR LPGRTSNDVK NYWNTYMRRK VHSHKKDNNI  120
EKQADEAKPI VKHHEVIKPV PRTLSKTSPW LQGKFVNSSK VGVSEEGATS ISGSAGNWWE  180
TLLDDKEDNA VNNNNTCFFG GADGEFNLWS EELTSIDCDF VTQGESWSDF LLDLQG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-2331111108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00213DAPTransfer from AT1G66370Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB9342801e-118AB934280.1 Glycine max gene for MYB transcription factor, complete cds, allele: R, cultivar: Clark.
GenBankAB9342811e-118AB934281.1 Glycine max gene for MYB transcription factor, complete cds, allele: r-m.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003533529.11e-175PREDICTED: transcription factor MYB75-like
SwissprotQ9FNV92e-56MY113_ARATH; Transcription factor MYB113
TrEMBLA0A0B2PQF01e-175A0A0B2PQF0_GLYSO; Transcription factor MYB113
TrEMBLA0A0R0IMD61e-175A0A0R0IMD6_SOYBN; Uncharacterized protein
STRINGGLYMA09G36966.11e-143(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.11e-57myb domain protein 113
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]